dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PPA09359 (Pristionchus pacificus )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PP18400 WBGene00098913 status:Partially_confirmed
Sequence length 143
Sequence
MANNGKVADKVCLIVIDGWGISEESHGNAILNAKTPVMDGLCSGNWTQLEASGEHVGLPE
GLMGNSEVGHLNIGSGRPVYQDIVRINMACRQNTLVKNENLIAACERAKKGTGRLHLAGL
VSDGGVHSHIGVFWNDFVDKMCL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]