dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|384536211|ref|YP_005720296.1| (Sinorhizobium meliloti SM11)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein SM11_chr1767 [Sinorhizobium meliloti SM11]
Sequence length 109
Sequence
MKQRNAKFEIGQVVRHRMFPFRGVVFDVDPEYANTEEWWNAIPQEIRPEKDQPFYHLFAE
NDESEYVAYVSEQNLVSDDSDRPIRHPQVDALFEKADAGHYKPKATYQH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]