dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSSARP00000002345 (Sorex araneus 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_5553:103339:109108:-1 gene:ENSSARG00000002609 transcript:ENSSART00000002590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 143
Sequence
MKPPPLLTFLCLLVAPAGGNLVQFGVMIERMTGKSALQYNDYGCYCGIGGSHWPVDPTDW
CCHAHDCCYGRLQKLGCEPKLERYLFSTTKCNIFCGGKTACQRQTCECDRTAALCFRRHL
RTYNRKYANYPNRLCTGPTPPCR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]