dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|313755|gb|CAA25616| (Xenopus laevis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment vitellogenin 1 (B1) [Xenopus laevis]
Sequence length 71
Sequence
MRGIILAQLLALAGSEKSQYEPFFSESKPYVYNYEGIILNGIPENGLARSGIKLNCKAEI
SGYAQRSYMLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]