dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSSARP00000006417 (Sorex araneus 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_1659:372980:376092:-1 gene:ENSSARG00000007080 transcript:ENSSART00000007078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 306
Sequence
DLKDTERCCWQHKQCGGHIIHPYTADCGHHNLHLHAVGHCDCDTRLKDCSEKVDSTTSSR
NPGPTCSHIIPTPCFEVIPEEECTDQFWYGWSEKYRPLIAVIHHPFHPKRREDVLEEEEE
EEEEGSKSPIPNQTGSVSPTETGPVTVTGTADSTAPITIWRSESPTAKPQANKTIKKIKK
KKEKEKEKDEDTDEKLKPKKKKKSKLVKKKSVVKAESSPPDSRSLCPRELTRTSESSPES
REELESEDSYNDPKREIFSPSEDIVESLPRKKEKNLPQAKKPGTKTSSTKKVTKRKSPPA
SIPNLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]