dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ORFP:11053 (Saccharomyces mikatae MIT)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment YIL024C, Contig c607 7319-7888 reverse complement
Sequence length 189
Sequence
MSNFLLVIPEDVIKGCSKADKLVVTGEFDNWRHSDYVLQYDGSAQNYRVQIPRRKGQRST
MFKVVINDKEWVTLNYFDTVTDKSGYTNNILHFKDNEASQLMDIPLSPHTRSNTVKGKPE
DDSLNDYVNLSSHSDLSSTEEIVCWNSDMEDENLDATIQCDFHQAFNSRKESLNGLMCIA
KKVKTYWNK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]