dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ORFP:12002 (Saccharomyces mikatae MIT)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment YJL053W, Contig c340 3747-4886
Sequence length 379
Sequence
MSIFFKSPIDIEILFDNEESRKHVDVATRTSNSSYKSMKESLPVYEDGESLGGIVTLRVR
DGKKVEHLGIKVSVIGSIDMIKSHSSGTSSTKKATSSTSSTSSNVSADVRKNSVDQFLCQ
SYDLCSAGELQHSQSFPFLFRDLSKRYESYKGRNVDVAYFVKVTVMRKSTDISKVKRFWV
YLYNSITTAPNTLSANEIQSNPKDINSESNTADNANQNKSIKGAQGGAADGNQVLPISHS
GNEPKPVRLDIGIENCLHIEFEYAKPQYSLKEVIVGRIYFLLTRLRIKHMELSLITRESS
GLQTSNVMTDSTAIRYEIMDGSSVKGETIPIRLFLSGYDLTPNMSCNYFNVKNYLSLVII
DEDGRRYFKQSEITLYRTR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]