dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ORFP:17538 (Saccharomyces mikatae MIT)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment YMR296C, Contig c470 19009-20685 reverse complement
Sequence length 558
Sequence
MAHIPEVLPKSIPIPAFIVTTSSYVWYYFNLVLIQIPGGEFIVSYIKKSHHDDPYRTTVE
IGLILYGIIYYLSKPQQKKSLQAQKPNLSPQEIDALIEDWEPEPLVDPSATDEQSWRVAT
TPVTMEMPIQNHITITRNNLKEKYTGVFNLASNNFLQLSATEPVREVVTTTIKNYGVGAC
GPAGFYGNQDVHYTLEYDLAQFFGTQGAVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSL
SVQNALQLSRSTVYYFNHNDMDSLESLLNELTEQEKAEKPPAIPRKFIVTEGIFHNSGDL
APLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGS
TGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSKVLKLMDSNHDAVQALQKLSKSL
HGFFASDDSLRPYVVITSSPVSPVLHLQLTPAYRSRKFGYTCEQLFETMSALQKKSHTNK
YIEPYEEEEKFLQAIVDHALINYNVLITRNTIVLKQETLPIVPSLKICCNAAMSPEELKD
ACESVKQSIVACCQETNK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]