dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gnl|GLV|KLTH0B06270g (Kluyveromyces thermotolerans CBS 6340)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment similar to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9 Aromatic aminotransferase catalyzes the first step of tryptophan phenylalanine and tyrosine catabolism [Kluyveromyces thermotolerans] Complete CDS. KLTH0B06270g
Sequence length 525
Sequence
MQALEEHYKPFLSSRVEARKFSPFWSQNLPEGLKPHPKPIDLGPGLPHEGFFPIESMHLN
VVEEPFQHTSAGTKSHKLHKPAPEGSKHFEERAFVTEKLSSDSAVDVWRYEPNSPEVIPL
SQGLQYTETAGMKQLLDFCRGFVSYAHPPAYNEWDVTLANGSSDATFKIIETLCDSSVTV
LVEEFTFSPTLAIITAAGGTTVPLKLDITADPDVQGINVEYLTDLLDNWSQGPNAHLSKP
KLLYTIPTGQNPTGMTLSFEKRKQIYALAEKHDFIIIEDDPYGYLRYPFYDRKNPDYNPY
ALHEYTAKDYCEKVLSKSFITMDTSGRVLRCETFSKVFCPGLRLSFIAGNKYLIKKIVDF
AEVSSRAPSGLSQLIVNNVIQKWAKSYSSPQEAWLVWVMKVAGHYTHRRNMFVQALEATE
AFSEGLFSLAQTSAGMFLAVEINFDHFAKSLSITERSKAMQRLSSISIEEGVGIIQGINM
AADRKYSLARSFFLRLTFAFAADVEELQEAADRLGKSVKRLAAEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]