dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gnl|GLV|KLTH0B09306g (Kluyveromyces thermotolerans CBS 6340)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment similar to uniprot|P25045 YMR296C Saccharomyces cerevisiae LCB1 Component of serine palmitoyltransferase responsible along with Lcb2p for the first committed step in sphingolipid synthesis [Kluyveromyces thermotolerans] Complete CDS. KLTH0B09306g
Sequence length 552
Sequence
MRQPPEVLPSSIPVPEAVLRSSSYVWYYCQRAAHAIPGMRYVVSYVRKSHQDDPYRTLFE
LFLIIYGIIYFFRKPRKQGEQAAPKLSEREVEALLDEWEPEPIAQQNIKLEWRAKSTPVL
MGNSSAPTRVNLTRDEGRESYSDVLNCASTSFLQISSDPEFVKAAKDTIHQYGVGACGPA
GFYGNQDVHSELEYNLARFFGTERAVLYGQDFCIAASVIPAFTKRGDVIVADDRVNVALQ
NALQLSRSTVYYYNHNDMEALEELLEQLQERELNEKLPSLPRKFIVTEGLFQNLGDIPDL
PRLVELKRKYKYRLLVDETFSLGVLGANGRGIAEYYNMKRDASVDITIGSLAVALGSSGG
FVLGDNVMSMHQRIGSHAYTFSAALPAFAVTTASRVLDHLEHDNSAVQKLRSLSQLMHQL
FIDDSELSPYIEVTSSKESSILHFRLTDEYRSRVFHTTEESLFQELSAMHAKNLSEKYIE
GCEREEKLLQRIVDMALKEHKVLLTRNTFVLKHETLPVTPSLKLCCSAKMTEDELRSACE
SVKSAVLACTSE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]