dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gnl|GLV|KLTH0E05236g (Kluyveromyces thermotolerans CBS 6340)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment highly similar to uniprot|Q06489 Saccharomyces cerevisiae YPR118W Methylthioribose-1-phosphate isomerase catalyzes the isomerization of 5-methylthioribose-1- phosphate to 5-methylthioribulose-1-phosphate in the methionine salvage pathway [Kluyveromyces thermotolerans] Complete CDS. KLTH0E05236g
Sequence length 417
Sequence
MSLEAIQFDRSHRDDISVRVLDQLLLPYTTKYVPIYTIDDGYTVINTMQVRGAPAIAIVG
ALAVLMEIQLLQNDGFARTQTFYDISSFELTRSALSQRLDFLLSSRPTAVNLSNALREIR
VLLAQSAGLAAFGNGVYDFVCRLIDEDLTNNVKMGDNGAAFLLDALQQEGFDEDFAVLTI
CNTGSLATSGYGTALGVVRSLWNDSLAKSQAPGDGSAKKRKLNQGRAKMVQVYPLETRPY
NQGARLTAYELVHDQIPATLIPDSSIAYRIATSPVPIKAAFVGADRIVRNGDTANKIGTY
QLALVCKHFGIKFFVTAPKTTIDSKTETGAGIVVEERKPNEFKHVSGTLIDSQTGLPCVD
NQDKPVSASVGVAPSEIDVWNPAFDITPHELIDGIVTEDGVFTKSASGSFDLTNLFA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]