dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427708371|ref|YP_007050748.1| (Nostoc sp. PCC 7107)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoribosylaminoimidazolesuccinocarboxamide synthase [Nostoc sp. PCC 7107]
Sequence length 253
Sequence
MLKSLPPTMSVHSKLYEGKAKILYTTDNPEVLLADFKDDATAFNAQKRGSILDKGRINCS
ISSQLFKKLEANGIRTHFIDSPAPNQMRVKAVKILPLEVVIRNIAAGSLSQQTGLPVGTV
LKQPLVEFYYKNDQLGDPLLTSDRLLLLELATAEQVDVIKNLALQINEFLRRFWQQCGIT
LVDFKLEFGLDSQQQILLADEISPDTCRLWDTAETDPNRRVMDKDRFRRDLGNVEDAYQE
VLQRVLQTVDTQN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]