dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc02g032270.1.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:18779568-18780389 transcript_region:SL2.40ch02:18779568..18780389- functional_description:"B3 domain-containing protein At1g05920 (AHRD V1 *-*- Y1592_ARATH); contains Interpro domain(s) IPR005508 Protein of unknown function DUF313 "
Sequence length 273
Sequence
MEDDDGGGLKEESCITDFECVDVEKDEAFRKNPFMCEHSVDHYYYLLPRAKRSRIFRRKN
PPPTVMPSQSMSQKKDPKIRISLKRKTIETVDEDLSVEGKKTETLFDEKHSKWENREEKR
RKIYKPIIDPPVLPDELKEMISGMGVQISQVKLVIQKVLYDTDLSYKHMRMSIPVNQVVR
KDFLTPQQKMVLETRDIESNKKSKIQFNLIEPSLEQTKIHLTKWDMSNSSSYVLLNDWMQ
VVKRNKLKSGMVVQLWSFHQHLVPWLALVSVRQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]