dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc02g062880.1.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch02 gene_region:29390445-29390802 transcript_region:SL2.40ch02:29390445..29390802- functional_description:"Unknown Protein (AHRD V1)"
Sequence length 86
Sequence
MYQDEDEDAYEDEEDEDKHLSQSYFECTIRQYCLSSDLMWIPKDFAFANGFIKGNKKYRL
IIIDETKTKLWNLMLKFCNILSLCCG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]