dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc07g017470.1.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch07 gene_region:7243989-7244279 transcript_region:SL2.40ch07:7243989..7244279+ go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os04g0386900 (AHRD V1 ***- Y4869_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence length 96
Sequence
MSKELPFDGAPAVLSYGGKKWNLIYGGAKTKYKFSTGWKNFADDNNLKEGDGLVFELSEC
NSDKIEFKIQILREDFPAELVPDVEGMNTNNPIIID

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]