dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc07g054630.2.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment genomic_reference:SL2.40ch07 gene_region:60218182-60225136 transcript_region:SL2.40ch07:60218182..60225136- go_terms:GO:0006355 functional_description:"B3 domain-containing protein Os11g0197600 (AHRD V1 ***- Y1176_ORYSJ); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence length 578
Sequence
MESCSNSYSAGSFYVIVEPSVMDDRQLRLPDKFVREHGDELLDTVKIIVPTDDFWCVGLK
KAGKMIWLHDGWQEFMEHHSVNCWYFLLFKYGQTSCFNVHIFDLAATEIDYQLRSHGYAK
SRDVAQDLSHRKDKIVGDNGFTSSIEIVDLLETEQGPESSAKSSELPHRAKRRKIASGKI
KITRCYETRSKTNKLHDNGQLLNAKNLNISGNGSLTKPVGGKSVRRSIKTPIHSAVATGG
TRKLFTSKQREKSLGRGRYDRRERAQQKVSETSRAIQTAKMFIPENPYFLQILEKYNVER
NYILNIPVEFVRKYMPKTSELIELQDTDGNKWKVRCIRRKLRVLLSKGWLNFVTDNSLLV
GDVCVFELLKNFQAVALILKVHMFRNRVEENSKNLHTGSLFEQTLSTGKNCVLQFDESKH
TKSSDAFEPLSSDRTNHKTDTENSFGQQQEKSVVHGSSGNRRKRGRPMDAEANTDTENSF
GQQQEKSVVHGSSGNRRKRGRPRDAEANTDTENSSRQQEEKSVVHGSSGNRRKGRRLRDA
KGNSATTAAKMFTPENPYFMITLGEYHVVRNYILFQWN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]