dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc09g007810.2.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment genomic_reference:SL2.40ch09 gene_region:1332643-1335760 transcript_region:SL2.40ch09:1332643..1335760- go_terms:GO:0003700,GO:0035198 functional_description:"Auxin response factor 3 (AHRD V1 **** A4L9W4_GOSHI); contains Interpro domain(s) IPR010525 Auxin response factor "
Sequence length 694
Sequence
MITFMDPKEKVKEVEKCLDSQLWHACAGSMVQMPSISSKVFYFPQGHSEHASGNVDFRSS
IRIPSYIPCKVSAIKYMADPETDEVFAKIRLIPVGRNEVEFDDDGVVGMNGSDNQDKPSS
FAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQTILAKDVHGETWKFRHIYRGT
PRRHLLTTGWSTFVNHKKLVAGDSIVFLRAENGDLCVGIRRAKRGIGGGPETSSGWNPAG
GNCMVPYGGFSSFLREDENKLMRNGNGNNGGNLMNKGKVKAESVIEAANLAASGQPFEVI
YYPRASTPEFCVKSSLVKSALQIRWCSGMRFKMPFETEDSSRISWFMGTISSVQVSDPIR
WPDSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPPRKKLRLPQHPDFP
LDGHLPMPAFSGNHLLGPNSPFGCLPDNTPAGMQGARHAQYGLSLSDLHFNKLHSSLFPV
GFPPLDQAAAAPRRPLNSPMISKPCNNENISCLLTMGNSAHSTKKSDIGKAPQLVLFGQP
ILTEQQISLSCSGDTVSTVRTGNSSSDGNADKIGNVSDGSGSALNQRGLTERSPCDTFQS
DPNTEIGHCKVFMESEDVGRTLDLSLLGSYEELCRKLANMFGIDNSEMLNHVLYRDTTGS
VKQLGDEPFSDFMKTARRLTILTDSSSDNVGIRE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]