dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc10g075030.1.1 (Solanum lycopersicum v2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch10 gene_region:58049176-58060149 transcript_region:SL2.40ch10:58049176..58060149+ go_terms:GO:0003700 functional_description:"AP2 domain-containing transcription factor (AHRD V1 *--* B9HWL7_POPTR); contains Interpro domain(s) IPR003340 Transcriptional factor B3 "
Sequence length 879
Sequence
MESKICMNGLCGTTSSIEWKKGWPLRSGEFATLCDKCGNAYEQLLFCDLFHSEDTGWREC
ISCGKRLHCGCIASSSLLELLDSGGINCISCVRSCQQHATPNHEKPKAFGTSISNSVGET
ASTSLGSQINGSEPNKREGSDSIDPALLLLHQNDNTNSPIGQIKMEETFHPAGESGSTFS
SNLFQASAEFSKNAKLDSYNGYKGVVEIHGSTVQTNLSIALSAPSPNSKLFPTTLDEGDL
NKTISSLQQGSRSRNLLPKPPKSASALGPEMNAGIISQIRVARPPVEGRIKNQLLPRYWP
RITDQELQQISGDSNSTIIPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLR
IQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRMDPEGKLLMGFR
KASTVKITQENRLSAIPKNVFSTEPTSFSAMPENLPLMSGYSGLLQSFKGSRESSVNLSS
KHFNSGDFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHDALELKLS
WEELQDMLRPPLSVQPTTVTIEDQEFEEYEQPPVLGKRSIFTVRLSGEQEQWAQCDNCFK
WRKLPADYLLPPHWTCQDNISDHSRSSCSIPDDLTPRELENLFKMDKDFKKQRSAAGQRI
TQAHDSSDLDSQANGISIAGDLGEPGPASVATTTKHPRHRPGCSCIVCIQPPSGKGKHNP
TCTCNVCMTVKRRFKTLMMRKKKRQSEREAELGQRNQLMWSSKEETEVDSFSRPVKPEVD
PSEKERSGSETLARGHSSYQLQKLPEITCLPLETYLRQNGLTSLVSEQQGSSGSQGLPQD
TRESDLRVQEDLCLASTAQEQEKDVPKENSEPDQTGKDQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]