dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc00g286020.1.1 (Solanum lycopersicum v.2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch00 gene_region:20941227-20942165 transcript_region:SL2.40ch00:20941227..20942165+ go_terms:GO:0003677 functional_description:"Plasmid partitioning protein RepB (AHRD V1 **-- B8ISQ1_METNO); contains Interpro domain(s) IPR017819 Plasmid partitioning protein, RepB "
Sequence length 312
Sequence
MPLLGVTRKERDPATKLTANIGNALREQNDRLSRAEEIERRLAEGQAVIELDASSIEPSF
VQDRMRGDIDGLLTSIREQGQQVPILVRPHPSQPGRYQVAFGHRRLRAVSELGLPVRAVV
RELTDEQVVVAQGQENNEREDLTFIEKARFAHRLNRQFSREIVIAAMSIDKSNLSKMLLL
VDALPSELTDAIGAAPGVGRPSWQQLAELIEKVSSPADVAKYAMSEEVQALPSAERFKAV
IASLKPSRVARGLPEVMATPDGTRIAQVTQSKAKLEITIDRKATPDFATFVLDHVPALYQ
AYHAENQRKRGE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]