dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Solyc06g076790.1.1 (Solanum lycopersicum v.2.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment evidence_code:10F1H0E1IEG genomic_reference:SL2.40ch06 gene_region:44091817-44092137 transcript_region:SL2.40ch06:44091817..44092137- functional_description:"Unknown Protein (AHRD V1)"
Sequence length 106
Sequence
MASLNMFVSPIATVTAQQHRSRVYTAATASKSSGGSTEEKSLLDFILGALQKQDQLLETD
PLLKKVEDKSVSTTSSGRKNSVAVPPKKNSNGGGFAGFGGLFNKKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]