dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

CGD0005431 (Theobroma cacao Matina 1-6 v0.9)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment aalen=489,64% Dbxref=vitis:XP_002272876.1,arabidopsis:NP_001118597.1
Sequence length 489
Sequence
MPDTQALVNDFLNQLKKRKIEGSQATAKQTAELLRSVISQTRVPYTNQAGALIDSVKAVG
ERLIAANPVGMKFDDYAMLLMRKLLAYIDTVSVVYAQTRTQCMDVMAELAVGNIVRRVLH
IIREEDVSLTTAAMAGLNLSAVSDDEDDADRDDRPVLSAAAVAAASRSTLRPPSLQTLLE
DVPDSAAVPHTSSSGGDSEGKSKSADKSSRSRKLKHDVIEAVNELIQDINTCHEQIAEQA
VEHIHQKGEHRAVWLASVVGEATTDQADRGGGTDRAKGEANQIVTNHGSSRTVLEFLCAA
KEKKRSFRVFVAEGAPRYQGHLLAKELVARGLQTTLITDSAVFAMISRVNMVIVGAHAVM
ANGGVIAPVGLNMVALAAQKHAVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGE
FSDCMDFGSGNGAPLLHVVNPTFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLV
VQRRPTSGN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]