dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|70606138|ref|YP_255008.1| (Sulfolobus acidocaldarius DSM 639)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment D-lactate dehydrogenase [Sulfolobus acidocaldarius DSM 639]
Sequence length 440
Sequence
MIQGIEYEERVEREDFVGFKIRPKMIVYPRTEEDVVKIVNYARETKTPIVTWGAGTSLSG
HLICDGCILLDMKYMDNIIEINEIDWYARVQAGVNLERLDKELEKRGFFLPPDPASFFLC
SVGGATANSSGGMRGVKYGTFKDWVLALKVVLPNGKVVKIGEPFTKNRGGYDLVHLFVGS
EGTLGIITEIWFKIIPLPRRKKYTILAYTDSLEDTAEVIVSLRKNKIMPELAEFVDYQVI
NALNKHLNAGLEEVRDGGALIISVEEDYLEELKKILGNKKYVVAEGEEAERIYSLRAQAA
IALKAEGKTMYIEDIVVPVSRLVEAIRRLREIERAYNVKMPTIAHIGDGNLHPNVIYDDP
KVGKKVFEEVAKVAIELGGSVSGEHGIGIQKAKLLGDQIISHNGKEVLELMKRIKDLFDP
YDIMNPNKYVELAYKLSENR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]