dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|70608060|ref|YP_256930.1| (Sulfolobus acidocaldarius DSM 639)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Saci_2356 [Sulfolobus acidocaldarius DSM 639]
Sequence length 646
Sequence
MKTVKSVSIVGLILLSLCLNTFLFTSQTTAGNQTTNSNAGVYIAPNNLLNPLASSPPTIP
VFTTTNQATFTFYVINSRSTQATIPVYVDSSLYTTLTLPPYSYKPISLQLSTGLHTISAN
SETVNVNVTTVQNAINGIMYLNGTPTLITINANPGKVYSLFYSYSPQVQNLSLISQGFIT
NLANNYWETSYVFPSPGNKLLIIVPQNISQGLYYAYYYSVFAGFVNGTEIPNSYVYGIVL
INVSYGIPSSLPSPVKYFGQGGISAFVENISGNTYLQINYPFSFQNVYNVTVLTNGKEQT
YILTNTSGGNYVILGTPYSPSVYGTNTQWSYSNSSIMLKLPQFSSGIVKVTGPYGNAVVN
LSESSKISLVTTTLKVVSVNGSPIQGATIDVYNMTTKSLITTLQTNSTGLTALQLPQGTQ
VEIYVKANGYLSNSTVLNVTQQGELTIYLKPIVVSITPSVVLVNGTQTSLVLTKTGYELA
KNITVGSTIEFNFTVKVSGMVMNNVSVTAYINGNMVTVESLGNGNYSVVFKPTNTGTYNL
TLVANYNGVSNRTMIEFYTHQLPVTTGTSTSTSTTTSTTTSTTTSSTSSTTTSSATTTTS
TSTITTTPQSSSTKPSTSSGFPVIPVIIVVIIVIVIVAIILLIRRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]