dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GRMZM2G137413_P01 (Zea mays subsp. mays )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment seq=translation; coord=4:117504937..117510920:1; parent_transcript=GRMZM2G137413_T01; parent_gene=GRMZM2G137413
Sequence length 511
Sequence
MASAGVAGCSGSAGDALFRELWHACAGPLVTVPRQGELVYYFPQGHMEQLEASTDQQLDQ
HLPLFDLPPKILCKVVNVELRAETDSDEVYAQIMLQPEADQSEPTSPDSEPPEPERCNVY
SFCKTLTASDTSTHGGFSVLRRHAEECLPQLDMTQNPPWQELLAKDLHGNEWHFRHIFRG
QPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRLMRQLNNMPSSVISSHNM
HLGVLATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNHKVSVGMRFKMRFEGDE
SPERRLSGTIIGLGSMPANSTSPWANSDWRSLRVQWDEPSAILRPDRVSPWELEPLDATN
PQPPQPHLRNKRARPPALLSIAPELPQVFGFLKSPAEPAQAFSFSRPQQTQELYHSNPSS
IFSSSLNVGFSSKNDRSTPINSHLYWTMRQTRTESYSASINKAPTEKKQESATSGCRLFG
IEIGSAVSPVATVASVGQDQPPALSVDVESD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]