dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

SPPG_04976T0 (Spizellomyces punctatus DAOM BR117 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | SPPG_04976 | Spizellomyces punctatus DAOM BR117 conserved hypothetical protein (753 aa)
Sequence length 752
Sequence
MTYKASGPTKVQSRYPTQYQQFAQKAKNGLRHVPEYSVDYVRGLFPIASWLPRYNRDWLY
GDLIAGLTVGIVVIPQALAYAKLATLPLQYGLYTSFTGVLIYALFATSKDVTIGATAVLS
QLTGQVLATYNADKSMDPVTFAIAVSFLTGLIQLALGLFRLGIIVDFIPAPVIAGFTTGA
GIGIIIGQFAGLLGIKGINTNDPAYQVLGNTLKALGQTQLDAAFGFAGLVSLLLFKFGCR
YAVKRGYPFMKWVSLSRNAVVIIIFTAISYAINHQNRKSPRIRIVGDIPKGFGPIHVPDV
SDLSKVAPASVTVVIVAILEHIAVVKSYGRLNGYRPDANQELVALGFTNFLGSFLGAYPA
TGSFSRSAIKSQSGVRSPLAALFTAAIVVLALYVLTPLFYYIPSAILSAIIISAISDLIS
RPALVKQLWDIQFLDLFAFLLALVFTFFFSIETGIYVSVGFAVAVLLYRLARPHYQVLAR
SNDTGIWVNVKDAQLGHTASPPPPGVLVFKLEESLTYPNANYFAEHIKEIMIESTEFGGP
ILKSNQKLWCDDTDDKIKRARKALAKKKAVSEQEIVPDIRLEIRDNDNSPSVTPPRKESV
DSGSHSDETLTSLPRLRAVVFDFSAVNGIDSTGVQTLVDLRRDMDAFAGQRVEIHFAHVR
PRFERILEYFLAITRTDRDVTPVVPTDIPIEETATNSNPPSSTDKNLVPFVDVRELFHAT
VDLAVAAIERRRSRASSFEKKQPEIDEIKVHS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]