dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

LH16941-PA (Linepithema humile v1.1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment genemark-scf7180001004924-abinit-gene-16.62-mRNA-1 protein AED:0.159886219347829 QI:0|0.61|0.59|0.92|1|1|27|0|3114
Sequence length 3114
Sequence
MATELANKKAEREALRGVIQQWNANRLDLFELSEPNEDLEFHGVMRFYFQDSGQKVATKC
IRVASDATSQAVIETLIEKFRPDMRMLSIPEYALYEIHENGEERKLGLEEKPLLVQLNWH
IDDREGRFLLRRIDDKTNAQGVGLISDGSSFRRKLSKREKKQIKKQEKLSRLKSLEQDEN
AAPGDQNGVAEKLYTELPETSFTRSISNPEAVMRRRRQQKLERKLQQFRSKDGGPDTGGT
LKIYGEALCKDVPYKTLLLSVRDSAAQVVREMLSKYGLDKVDSQLYCLVQVNSENMGSNV
HQEYILDDDECPLAILMNHPSTRGSIMFHVRRRPADYMPRKRKKKPAGKWNELDHRYEDE
RLPFLLELNSDGSDIPNGAGVRHRLQPNVTEVGSERPIGPQAVQAQTLTLPGPTVMPRHC
VIAFTENIVTLTPCSRDAHTYVNNQRIHQTTILQNGAIVKFGRMYTFRFIDPAPEERIRQ
RHDSNKQIDYAYDRRSPDATSQDVSSEKFHPGSATSNGSGGQTPGQTQERAAPSSPSKSA
AVAARSPRSPTHPPESTHNYETTFDLDGNVETASLSSSRDGNRLSQYDRQAWGADPILPA
VLEFLEETEEAFLHAVITDVEPSAPQFKLAPTYTLYLSARYRASTHYRPELQPTERAHRL
TLMLANVATMIQRVIQERYMNASSLAFWLANGSELLHMLKSDRHVGAFSTRAQDILVDAV
HTAFGSLVRCVTLELTPAMTQFMADADEPAKEAGVLQIFSNTMTLLRRCRVNAALTIQLF
SHLFHAINATAFNTLVSNGNLCVRWFGRRLKARLNALETWAERQGLELASQCHLATIMQA
THLLQAPKYNAEELATLSSTCFKLNSLQVRALLQKYQPATDEPRLPAELIENVVRVAESV
ADTLARADGREIRLEEEPVLGLALLLPEDGYSCEVIRGVPPGLAEFLAPLQRDGLCRMAA
QPTSSGYWTIYMIDHHNNMRSPSAMSNRSGGYVGHINQNQAQPEIQVIKLHKSTNGMGLS
IVAAKGAGQDRLGIYIKSVVAGGAADADGRLTAGDQLLKVDGQSLVGITQEKAAEYLVRT
GPIVTLEVAKQGAIYHGLATLLSQPSPVMTRAYKTRPKSELLEPAVGAAEATGGQPAASR
SMGDLLSFPKRATSQSLAQPGATTSQCAIEAPFYPNRPIDRGFPRSDPTESRFAQQDPFS
ACRPRSAYHRAFYPVDEFRGAVDRREYSCRPSTPTVSPVRLPGLRMPCPLISITCDNEMP
SIVYQDDESDGKITEEDESAAERGEIAAGDSTDSFDPFERIATPPREYAEAAIDYKHSLL
ARPLALHTNVFDNIPYIDQTDDANFTESSECVEGERRECKRCDKGDCDGNSNFRDSQKCV
ATADRRRAATSQESDFEFDACCDVKCSSTDASPLTNELVVKDATIAPGFVTESPSNDSLR
LGSLNTGAKRTLNIDEQDKLDDISNSDYADESSSTIYDDDGSNRDAGEEISTSKMYTAMP
ELHLDLSGLNSDISSDESKTEKCWKSPEEVRLGCGRVAALAKHFSKLGDAGLIKFKTTKL
TDFRQFVSEPNITASETSGVPSRAQKGCKSDSDLAREANGNVQIGENGDLISTSVETDDD
LAIEECRFHRCGAKRVTVSGTSSLNEERVDARKNSVPTTDDEDCDANESRLAGDCKSTPV
ERVGKMEDSSRLSLKQQQVIAQQLEQFSNLDDTDAPLFIPEQSAKRASSVSLKSETDGGA
SAFGDSTRSNLTDQAATASRERLPSSSDGRTRQQASSPPLSSSLPSVHFPSSSVALSLSN
VKNSLSAEDKSQVYRYVSEKYPNSRLFLDISYSSAKSCSDDNLKSLALPSRANVHLRSQD
DKFDTLRVQIARPLCRSENNLIGAAICEREEACHGGSHAKLTRNCKNTPSCKRLSADEME
LSENPCQEIDSSRDGAKNAKLEGKARSYHRSLEELKLNKRGISSASSASTRIVQVPKRFD
DKLDSENKRGTRWNRHRSFEVLKSRRELSEQHSRMNPAAELPREKSRAKRVSHDWPRGSA
LELSRGSETEDEERQRWRTKRKSRSELDISKRKPDLERNDWSFREISSLNDQSASRPRRM
SERDLSSRLGYDATPQQIHSSKSVPALHNMGTEVKQQHEVFNPGYSRASSSNSVTPPVQP
PPMATINSATALRSRSSHNLHDPMRAGALPPTGLVSRQQSSPNLNPNVTHANVPLNAQNT
EVERFYQNLSIYRNQEAALKQQLSPQQSDDRNLQHNQNQKNTLRGSQNSLNRPSTLEATN
YIRDRPTSAYVTQGQQQSYSAVGSQMQQQNVGPSSRSQSTRDIIRQEAKMQEMQEEVRRR
ELRGGAPMLGQHRPPMYNVGARGVAPATQQAPPNALSVALPKPSLGSTSNLGVASGYAAR
QNAPGYNYTDIQHVQHNNAQYNQYGQYNQYPNRYPVSGGQYGSMLLKPKNEAVIRGHQSM
PHESPLGKDQHNQQEAKASAEQSRHFAGSQNSPHYPNGSLEQRVDQYTNDGMINRAQNGE
SNPAATSEVPPTRPTLPSEEFNESPPPPPPDTSTHPLYNKQADMRYMASMQDPPRGSYYP
AGGISAMQQPRQYQYSATNPWQREEREKEQARRREAARQWRDQQIAELSALTHRTQQQEE
QLRALQLERDFQKRAEEAANQDDDEESNDLDNESTQRIQDLFRMAASQERTIQGTQQPPI
LSRTNVGNQSIRGGLSLQLVGNQPVISGHTHILSGQAATQNVGASGADQEGGDLHVQSSH
QQQQQQQQQQRMPANQSEEQMHMPTNYGTPLGSHFSSGQKSYSMGMLHSIEDKELQRKMD
ETKRKQADLEESQKKQEEHQLHSQQQAYQQSQHARSQQSLHPSMLRLDNLIINGSNVPMH
GNSLGIFMFFVNVEIADVVYFCPLQHNINDAPPPPERGSSYAVMSQQNALRSNSSIASNL
PPASQQPPSLKRVSFHDSNANSEPTLRNVSSATPNPPSFSMNTIREDPNNFINDAENLLA
SPKTPEGSGTSFSGATPGVIGAQEVYKDPRQKRLAEKQKQQNLQIGAVPEKLSFKEKMKM
FAMETGEDGTPRDKVKISRAQREIDNISSPLNSNNNNNNINNISGNNNTNSNRT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]