SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222474878|ref|YP_002563293.1| from Anaplasma marginale str. Florida

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222474878|ref|YP_002563293.1|
Domain Number 1 Region: 150-397
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-51
Family Extended AAA-ATPase domain 0.0000213
Further Details:      
 
Domain Number 2 Region: 14-194
Classification Level Classification E-value
Superfamily CheY-like 1.85e-38
Family CheY-related 0.00054
Further Details:      
 
Domain Number 3 Region: 366-463
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000493
Family FIS-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222474878|ref|YP_002563293.1|
Sequence length 466
Comment nitrogen assimilation regulatory protein (ntrX) [Anaplasma marginale str. Florida]
Sequence
MGFMSRAKRFYTPEVLIVDDEADLRAMVQDILSDDNYVTKISHDGLTAIKLAYEREPDVV
LLDIWLKGSDIDGLSVLEKLRYRYPHLPVIVISGHGNIATAVKSLHIGAYDYIEKPFTES
RLKLVVKRAVESGRLKRENYELRSLFEDYEIVGSSPQIKNLRSTISKAASTCSRILITGA
PGTGKEVVARFVHRKFKGCNSSFVPFCPSILPESSYLENIFGSESGNGALPNVVPHSVGI
IEQANHGTLFIDEVTDLRYDAQMRLMRLLQEGRIYRENGKNPVTIDTRVIASSSRVIEEE
VKLGRFCEDLYYRLGVFPIRVPSLSEYCVDIPEVCEYMMRSICRKMGLSPRPISEDAIVA
MQSYSWPGNLRQLRNVLEWILIMQSSKDIITIDDLPAEIVSGSPINNVFTHIVSAPLRKA
REEFERHYLRTQLSRFGGSVSKTAEFIGMERSALHRKLKALGLCGS
Download sequence
Identical sequences B9KHS5
gi|557625423|ref|YP_008785762.1| WP_012658840.1.11087 WP_012658840.1.19914 WP_012658840.1.23764 WP_012658840.1.77589 WP_012658840.1.83377 WP_012658840.1.83909 320483.AMF_153 gi|222474878|ref|YP_002563293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]