SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222474967|ref|YP_002563382.1| from Anaplasma marginale str. Florida

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222474967|ref|YP_002563382.1|
Domain Number 1 Region: 10-267
Classification Level Classification E-value
Superfamily Thiolase-like 1.55e-71
Family Thiolase-related 0.000000969
Further Details:      
 
Domain Number 2 Region: 230-425
Classification Level Classification E-value
Superfamily Thiolase-like 4.37e-70
Family Thiolase-related 0.00000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222474967|ref|YP_002563382.1|
Sequence length 427
Comment 3-oxoacyl-ACP synthase II [Anaplasma marginale str. Florida]
Sequence
MFRFCMADRARVVVTGMGLVTPLGFQIPDVWDRLVNGKSGISAISGFDTHDLECRVGGQV
ISEGQSGENVFDPTQWVEEKDVKKADRFIIFGVAAADMALSDAGLLGTEFDPDRIGVLVG
SGVGGLPCIERNVIAVHERGPRRVSPFFIPGSLVNLLPGHISIRHGLTGYCNASVSACAT
GAAAIADAARVIASGEADVMLAGGAEGALCRAAVAGFCIIKALSTKFNDTPELASRPWDR
DRDGFVIGEGAGILVLESYEHAKMRGANIYAELVGYGITSDAYHVTAPHPEGRGGADAMK
RALQMSGIAPESVGYINAHGTSTPVGDSVEISAIKSVFGDHAYRMPISSTKSSIGHLLGA
AGGVEAIFSILSIRNGVVPPTLNLQNSSEDSNLNLVPLNAQEHKVSSAMSNSFGFGGVNA
SLVFGAV
Download sequence
Identical sequences B9KI14
gi|56416601|ref|YP_153675.1| gi|557625505|ref|YP_008785851.1| gi|557237606|ref|YP_008769322.1| gi|222474967|ref|YP_002563382.1| 234826.AM338 320483.AMF_252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]