SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229918416|ref|YP_002887062.1| from Exiguobacterium sp. AT1b

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229918416|ref|YP_002887062.1|
Domain Number 1 Region: 9-195
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.91e-73
Family HD domain 0.00000052
Further Details:      
 
Domain Number 2 Region: 185-397
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.13e-66
Family RelA/SpoT domain 0.00000683
Further Details:      
 
Domain Number 3 Region: 380-453
Classification Level Classification E-value
Superfamily TGS-like 3.43e-24
Family G domain-linked domain 0.027
Further Details:      
 
Domain Number 4 Region: 650-727
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000204
Family Glycine cleavage system transcriptional repressor 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229918416|ref|YP_002887062.1|
Sequence length 729
Comment (p)ppGpp synthetase I SpoT/RelA [Exiguobacterium sp. AT1b]
Sequence
MTKKQIVSIEDLLDALGEYMGDDDIAEVKRAYEYAKLHHTGQFRRSGEPYILHPVQVAGI
LVDIGLDATTIIGALLHDVVEDTDISLQQLTDDFGPDVAMLVDGVTKLGKIKYKSKKEEL
AENHRKMIIAMAEDVRVILIKLADRLHNMRTLQHMPKEKQVQKAEETLEIFAPLAHRMGI
STIKWELEDISLRYINPQQYYKIVSMMKQKRTEREALVTSVITEVNGVLEEVHIDADVNG
RPKHIYSIYNKMVKHKKEFNEIYDLMAVRIIVDSIRDCYAVLGIIHTQYKPMPGRFKDYI
AMPKPNMYQSLHTTVIGPKGEPLEVQIRTKDMHFIAEFGIAAHWAYKEGKNVSTNGFDEK
IAHLREILELQKDTTDAEEFMESLKVDFFSDMLYVFTPKGDVFELPKGSVPIDYAYRIHT
EIGHRMTGAKVNGRMVPLDYKLETGDIIEIITSKHSYGPSKDWLKLAVSSQAKNKIRQWF
KRQQREENVEKGKDLVEAEIKKLGFEPKEIIDEPALSIVVEKFNFGNEEEMYAAVGYQGI
TAAQVAHKLTEKQRKEPKLELSEAISELKVSQAPKKKTAEAGVTVKGIDNMLVRMSRCCN
PVPGDEIVGYITRGRGVSIHRKDCLNIVNEQHPERLLDVEWEVGQAKEKNYNVDIEITGY
DRSGLLNDVLQAVSATNTNIVAVSGRGDQNKQARISMTISIPNVNHLQKVVERIKQISDV
YSVSRVMMT
Download sequence
Identical sequences C4L532
360911.EAT1b_2702 WP_015881176.1.32866 WP_015881176.1.48863 gi|229918416|ref|YP_002887062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]