SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238650463|ref|YP_002916315.1| from Rickettsia peacockii str. Rustic

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238650463|ref|YP_002916315.1|
Domain Number 1 Region: 165-394
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.34e-86
Family CAT-like 0.000000096
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily Single hybrid motif 4.19e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.00028
Further Details:      
 
Domain Number 3 Region: 111-149
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000484
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238650463|ref|YP_002916315.1|
Sequence length 395
Comment dihydrolipoamide acetyltransferase [Rickettsia peacockii str. Rustic]
Sequence
MRVKIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTDGANIAVGEEIGEINEGASVNTAGTNNESARAQAVTQPTSEKPAVANNTLAPSVQKLV
TENKLDPNNIKGTGRDGRITKGDVLATINTTTTSAPAISKSNEERVQRVRMSRLRKTIAQ
RLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIEALKLIP
SVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKTIGILAKQAREGK
LSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIHPMMYI
ALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
Download sequence
Identical sequences C4K116
gi|238650463|ref|YP_002916315.1| 562019.RPR_02090 WP_012736541.1.93503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]