SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378170|ref|YP_001314765.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378170|ref|YP_001314765.1|
Domain Number 1 Region: 31-219
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.95e-48
Family ETFP subunits 0.0079
Further Details:      
 
Domain Number 2 Region: 237-355
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.67e-43
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150378170|ref|YP_001314765.1|
Sequence length 370
Comment electron transfer flavoprotein alpha/beta-subunit [Sinorhizobium medicae WSM419]
Sequence
MSTENREACSPPSGRAATKKELPKQFQDYRNVWVFIELEHGQVHPVSIELLGEGRKLADK
LGVHLAGVVIGPPGGQGTANAIADAFAYGADLSYLVESPLLAHYRNEPFTKALTDLVSAN
KPEILLLGATTLGRDLAGSVATTLKTGLTADCTELNVDSDGSLAATRPTFGGSLLCTIYT
LKCRPQMATVRPSVMAMPQRVNKPTGSIIRHELKMLEEEIATKVLAFFSDGDSNTANLAY
ADVVVAGGLGLGAVQNLQLLKDLARTLGGDFGCSRPLVQKGWMPVDRQIGQTGNTIRPKL
YIAAGISGAVQHRVGVEGSDLIVAINTDPNAPIFDFAHLGVVADAISFLPALTEVFTKRL
EPRNLEKFVQ
Download sequence
Identical sequences A6UMF2
366394.Smed_6229 gi|150378170|ref|YP_001314765.1|NC_009621 WP_011970921.1.7720 YP_001314765.1.44884 gi|150378170|ref|YP_001314765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]