SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395257|ref|YP_001325724.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395257|ref|YP_001325724.1|
Domain Number 1 Region: 173-461
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.89e-86
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000235
Further Details:      
 
Domain Number 2 Region: 439-759
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 5.76e-82
Family Phosphotransacetylase 0.0000327
Further Details:      
 
Domain Number 3 Region: 19-171
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 4.46e-53
Family Malic enzyme N-domain 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395257|ref|YP_001325724.1|
Sequence length 761
Comment malic enzyme [Sinorhizobium medicae WSM419]
Sequence
MPGIDRSDRAMTSVTAQEALDFHSQGRPGKLEISPTKPMATQRDLSLAYSPGVAVPVKAI
AEDPATAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGKAVLFKRFADVDSIDLE
VDTDDVDEFVNCVRFLGPSFGGINLEDIKAPDCFIIEQRLREVMDIPVFHDDQHGTAIIA
AAGLINALTLTGRDFKSTKLVCNGAGAAAIACIELIKSMGFNPANIILCDTKGVIYKGRT
DGMNQWKSAHAVETDRRTLAEALDGADVFFGLSAKGALSADMVRSMGERPIIFAMANPDP
EITPEEVADIRNDAIVATGRSDYPNQVNNVLGFPYIFRGALDVRASTINDAMKIAAAEAL
ANLAKEDVPDDVAAAYQGNRPRFGPQYIIPVPFDPRLISAIPMAVAKAAMETGVARKPIE
DLKAYGEQLSARRDPIASTLQRIVERVRRQPKRIVFAEGEEVQMMRSAIAYANQQLGTAL
LLGREEVMRETAEREGIDLDRAGIQIVNARLSKRVGAYTDFLYSRLQRKGYLFRDVQRLI
NTDRNHFAASMVALGDADGMVTGLTRNYSTALEDVRRCIDPKPGHRVIGVSIALCRGRTV
LVADTAVHDMPTSEELADIAEEAAGLAKRLGYVPRVAMLAYSTFGHPSGERSERVREAVK
ILDRRRVDFEYDGEMAADVALNARVMEQYPFCRLSGTANVLVMPAFHSASISTKMLQELG
GSTVIGPLLVGLDKSVQIASMSAKDSDLVNLAAIAAYNAGT
Download sequence
Identical sequences A6U5F9
WP_011974244.1.29075 WP_011974244.1.61285 WP_011974244.1.7720 WP_011974244.1.89664 YP_001325724.1.44884 366394.Smed_0029 gi|150395257|ref|YP_001325724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]