SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395462|ref|YP_001325929.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395462|ref|YP_001325929.1|
Domain Number 1 Region: 426-606
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.49e-37
Family Histidine kinase 0.0000141
Further Details:      
 
Domain Number 2 Region: 2-127
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 6.67e-31
Family Chemotaxis protein CheA P1 domain 0.00083
Further Details:      
 
Domain Number 3 Region: 607-741
Classification Level Classification E-value
Superfamily CheW-like 3.27e-26
Family CheW-like 0.00063
Further Details:      
 
Domain Number 4 Region: 361-423
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000188
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395462|ref|YP_001325929.1|
Sequence length 759
Comment CheA signal transduction histidine kinase [Sinorhizobium medicae WSM419]
Sequence
MDMNEIKEIFFQECEEQLAELETGLLKLNDGDRDPETVNAVFRAVHSIKGGAGAFGLDDL
VSFAHVFETTLDCVRSNRLEPTQDVLKVMLRSADVLADLTNAARDGGSVDGGRSRQLIKE
LEALANGELPQAATEPVPKAVPSAAAPVAPVVNEEGFQPVAFSFDDFEAGDELTIEPVAY
EIVFKPKSDLYAKGNDATLLLRDLSRLGEMSIHCDMDGLPPLDRLNPEEAYFSWKISLST
DKGEEAIRSVFEFAEWDCDLEVAVAGGLIGMDEELPMQPVPFDLSILDEEAQMPAGEEDR
AYPHEGEAQNATIPAAETASNVLQMAQSAARVSPENVRNPTSASTAQNIAAQQAASAATP
TIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTNGTSSINMGLEELQQLTREIQDSVM
AIRAQPVKPVFQRMSRIVREIADMTGKSVRLITEGENTEVDKTVIDKLAEPLTHMIRNAV
DHGLETPDKRIAAGKSPEGTVRLTAKHRSGRIVIELADDGAGINREKVRQKAIDNDLIAA
DANLSDEEIDNLIFHAGFSTADKISDISGRGVGMDVVKRSIQALGGRINISSRPGQGSIF
TMSLPLTLAVLDGMVVTVANQTLVVPLTAIVETLQPEASAIHSFGASQRLIAIRDSFCPL
VDVGRILNFRGAQANPVEGVALLVESEGGGQRALMVDAIQGQRQVVIKSLEANYTHVPGI
AAATILGDGRVALILDVDAIVAASRGQSLRPEMPLAAAG
Download sequence
Identical sequences A6U614
366394.Smed_0235 gi|150395462|ref|YP_001325929.1| WP_011974445.1.29075 WP_011974445.1.61285 WP_011974445.1.7720 YP_001325929.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]