SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395826|ref|YP_001326293.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395826|ref|YP_001326293.1|
Domain Number 1 Region: 19-182
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 6.74e-37
Family Extradiol dioxygenases 0.063
Further Details:      
 
Domain Number 2 Region: 182-294
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.97e-21
Family Antibiotic resistance proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150395826|ref|YP_001326293.1|
Sequence length 296
Comment glyoxalase/bleomycin resistance protein/dioxygenase [Sinorhizobium medicae WSM419]
Sequence
MMMDTSHLKPVSFPADHATAMPAYVDQSHLVVSDLDAVSSWYQRILGLSPIDTSTNGVTL
GVAGTPLLTLTGGGSAKKAPVSAPGLFHHAFLVPDRAGLGRWLVHASENGVQLQGASDHL
VSEAIYLADPEGNGIEIYRDRPREEWNYSADGMVAVNTLPLDLQALYDETPKSGWNGLPP
GTALGHIHLQVSDIPQAEAFFRDALGLDLMARYPGASFFATGKYHHHVAANIWNSRGAPK
RQGNITGLADYTIRFRDPAVLAATIEKLDALELVVNRSGSAYSLIDPWGIGLNLEG
Download sequence
Identical sequences A6U728
gi|150395826|ref|YP_001326293.1| 366394.Smed_0602 WP_011974804.1.29075 WP_011974804.1.31871 WP_011974804.1.61285 WP_011974804.1.7720 WP_011974804.1.89664 YP_001326293.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]