SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395864|ref|YP_001326331.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395864|ref|YP_001326331.1|
Domain Number 1 Region: 552-832
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.48e-77
Family GlnE-like domain 0.00031
Further Details:      
 
Domain Number 2 Region: 45-314
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.53e-67
Family GlnE-like domain 0.00011
Further Details:      
 
Domain Number 3 Region: 315-467
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 1.65e-44
Family Glutamine synthase adenylyltransferase GlnE, domain 2 0.000083
Further Details:      
 
Domain Number 4 Region: 834-983
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 3.22e-28
Family Glutamine synthase adenylyltransferase GlnE, domain 2 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395864|ref|YP_001326331.1|
Sequence length 985
Comment bifunctional glutamine-synthetase adenylyltransferase/deadenyltransferase [Sinorhizobium medicae WSM419]
Sequence
MAETVERSLSDIDVVPIRPASQADAKAALSVLKDAAKCSDRIAERIASGAPLKDFLVAAF
ALSPFLRDTAGGHPAVLEALLSETLPAFLKRRIEAARTAWRGEATGAALADTEIMMRLRR
AKREVAFAVALADLSRLFSARETTRWLSDFAEAAVSAAIDHLLLGAHESGKLELKDSSAP
SAGCGVVVLGMGKLGAGELNYSSDIDLVVFYDPQSSIITSRDDAPETFARLLRRLVRILQ
ERTGDGYVFRTDLRLRPDPGSTPLAIPVEAAMLYYESRGQNWERAAFIKARPIAGDLEAG
ERFVRELTPFVFRKYLDYAAIADIHSIKRQIHAHKGHGEIAVKGHNIKLGRGGIREIEFF
VQTQQLIAGGRTPALRLRETEAMLRMLAESGWIDGTTAEELTEAYWFLRDVEHRIQMVHD
EQTHLLPETEAELKRIAYMLGFEDTSSFSKALSGVLRTVERRYAQLFEQEVKLSAETGNL
VFTGEQDDPDTLETLKKLGFQRPSDIARIIRTWHYGRYRATQSVEARERLTELTPELLRF
FGESRRADEAFLRFDHFLSGLPAGIQLFSLLGNNPGLLSLIVNIMSSAPRLADIIAAKPH
VFDGMLEPGLLSELPTRDYLAPRIANFVAGGRHYEEVLDRLRIIAAEQRFLIGIRLLTGA
ITGLQAGRALTDLADLIIASALDAVLEEIRSVHGRFPGGRVAIVGMGKLGSHELTAGSDI
DLILLYDYDDEVLESDGAKPLDPVRYFTRVTQRLIAALSAPTAEGILYEVDMRLRPSGNK
GPVATRIAAFAKYQRTEAWTWEHLALTRARCICGDESLVGEAEAIFAEVLACKRDIAKIR
KDVEEMRGLIDKEKPPKDIWDFKLIPGGLVDIEFIAQYLTLIAPARGLTPPPAGTHTLEA
LKALGAGMMDANDLDTAAEALVLFTELSQLVRLCIDGDFDPKEAPAGLVDLVCRAGDYPD
LSHLEADIRRLSKAVRRIFHSVIAA
Download sequence
Identical sequences A6U766
gi|150395864|ref|YP_001326331.1| 366394.Smed_0640 WP_011974842.1.7720 WP_011974842.1.89664 YP_001326331.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]