SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396023|ref|YP_001326490.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396023|ref|YP_001326490.1|
Domain Number 1 Region: 1-201
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-66
Family DnaQ-like 3'-5' exonuclease 0.000084
Further Details:      
 
Domain Number 2 Region: 187-296
Classification Level Classification E-value
Superfamily HRDC-like 1.29e-26
Family RNase D C-terminal domains 0.014
Further Details:      
 
Domain Number 3 Region: 298-366
Classification Level Classification E-value
Superfamily HRDC-like 0.000000000000101
Family RNase D C-terminal domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150396023|ref|YP_001326490.1|
Sequence length 383
Comment ribonuclease D [Sinorhizobium medicae WSM419]
Sequence
MIQTTADLEAACRELASSSYITIDTEFLRETTFWPELCLIQMASPDMAVIVDPMAPGIDL
ASFFALMGNADVVKVFHAARQDIEIIHHLGNLIPHPLFDTQVAAMVCGFGDSVSYDQLVS
RIKNEQIDKSSRFTDWSRRPLTDKQLDYALADVTHLRDIYHYLVQELEREGRSSWLAEEM
AILENRETYDLHPDNAWQRLKMRVKKPIELAVLQKVAAWREREARARNVPRGRIIKDDAI
YEIAQQQPKDSEALGRLRTIPRGWERSSAGTALVEAVGEALAIPKTELPRLPRQNHAPEG
VAAASELLKVLLKLTSEKEGVAAKIIANSDDLEKIAAEGDSADVAALKGWRRELFGETAL
KLINGEVALRFVDKKVEAMEIGG
Download sequence
Identical sequences A6U7M5
366394.Smed_0799 WP_011974997.1.7720 YP_001326490.1.44884 gi|150396023|ref|YP_001326490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]