SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396768|ref|YP_001327235.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396768|ref|YP_001327235.1|
Domain Number 1 Region: 442-765
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 8.22e-86
Family Phosphotransacetylase 0.0000362
Further Details:      
 
Domain Number 2 Region: 176-454
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.42e-83
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000302
Further Details:      
 
Domain Number 3 Region: 23-174
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 1.22e-53
Family Malic enzyme N-domain 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396768|ref|YP_001327235.1|
Sequence length 770
Comment malic enzyme [Sinorhizobium medicae WSM419]
Sequence
MNTGDKAKSQAVPASGDIDQQALFFHRYPRPGKLEIQPTKPLGNQRDLALAYSPGVAAPC
LAIRDNPETAADFTARANLVAVVSNGTAVLGLGNIGPLASKPVMEGKAVLFKKFAGIDVF
DIEIDAPTVERMVDVISALEPTFGGINLEDIKAPECFEVERRLREKMEIPVFHDDQHGTA
IIVAAAVLNGLELAGKDIAKAKIVASGAGAAALACLNLLVTLGARRENIWVHDIEGLVYQ
GREVLMDEWKAVYAQESDHRVLADSIAGADVFLGLSAAGVLKPELLVQMAEKPLIMALAN
PTPEIMPEMARAARPDAMICTGRSDFPNQVNNVLCFPHIFRGALDCGARTINEEMKMAAV
RAIAGLAREEPSDVAARAYSGETPVFGPDYLIPSPFDQRLILRIAPAVARAAAESGVATR
PIQDFDAYLDNLNRFVFRSGFIMKPVFAAAKNASKNRVIFAEGEDERVLRAAQVLLEEGT
AKPILIGRPQIIETRLRRYGLRIRPDIDFEVVNPEGDPRYRDYVDDYFALVGRLGVIPEA
ARTIVRTNTTVIGALAVKRGEADALICGVEGRYSRHLRDVSQIIGKRSGVLDFSALSLLI
SQRGATFFTDTYVSFSPSAEEIAQTTVMAANEIRRFGITPRAALVSHSNFGSRDSESAFK
MRAALQIVRELAPDLEVDGEMHGDSAISEGLRQRVMPDSTLNGEANLLVFPNLDAANITL
GVVKTMTDSLHVGPILLGSALPAHILSPSVTSRGVVNMAALAVVESSYPV
Download sequence
Identical sequences A6U9S0
366394.Smed_1558 gi|150396768|ref|YP_001327235.1| WP_011975708.1.29075 WP_011975708.1.31871 WP_011975708.1.61285 WP_011975708.1.7720 WP_011975708.1.89664 YP_001327235.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]