SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397931|ref|YP_001328398.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397931|ref|YP_001328398.1|
Domain Number 1 Region: 134-252
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.95e-23
Family Methylmalonyl-CoA epimerase 0.057
Further Details:      
 
Domain Number 2 Region: 4-120
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.01e-21
Family Antibiotic resistance proteins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150397931|ref|YP_001328398.1|
Sequence length 253
Comment glyoxalase/bleomycin resistance protein/dioxygenase [Sinorhizobium medicae WSM419]
Sequence
MHGKFVWYELMTTDMKAAEAFYTDIVGWSARDAGMAGMDYTLFSAGDHQIAGLMTMPDGA
LEMKVPPAWLGYIAVEDIDEVAARVGTEGGKVHRAPEDIPNIGRFAIVTDPHGAAFSLFQ
ANGEPPPHLEQMAPGNVGWHELMAGDLETAFSFYSNLFGWTKDQAMDMGDMGVYQIFAHQ
GQPIGGMMTKPKEVPSPFWLYYFNVDAIDAAIDRAQSGGAKLLLEPMEVPGGAWIAQFTD
PQGAVFALVAPKR
Download sequence
Identical sequences A6UD33
WP_012066948.1.29075 WP_012066948.1.31871 WP_012066948.1.7720 WP_012066948.1.89664 YP_001328398.1.44884 gi|150397931|ref|YP_001328398.1| 366394.Smed_2733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]