SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134288158|ref|YP_001110321.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134288158|ref|YP_001110321.1|
Domain Number 1 Region: 30-114
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000135
Family Eukaryotic proteases 0.062
Further Details:      
 
Domain Number 2 Region: 18-155
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000255
Family Eukaryotic proteases 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134288158|ref|YP_001110321.1|
Sequence length 271
Comment hypothetical protein Bcep1808_6626 [Burkholderia vietnamiensis G4]
Sequence
MDERLKQFMDDSERIRAHLRDFSVTIVTMTAEPKPAAIGSGTLVKIGERYGIFTAAHVVR
DVPKERFCLVFAERQEGLNAFISSVRLDGGRAYPDGTSDLLDVAFLELSAEGVETVGRHK
QFLPESRIEVGTAYRDARFVGYGTPRTLVAGSGTQLRAKPLFYVTEATSVRTNGRTIDDH
IFLEYPRAGNIHLADGSAFGLKPDESRLLDDPRGISGGGIWTPRLDGGDYSNPETFALVG
ILAGFIPGCRHIVGNQIQHALMVINKAVEPN
Download sequence
Identical sequences A4JTB5
gi|134288158|ref|YP_001110321.1|NC_009230 269482.Bcep1808_6626 gi|134288158|ref|YP_001110321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]