SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258511735|ref|YP_003185169.1| from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258511735|ref|YP_003185169.1|
Domain Number 1 Region: 128-182
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000881
Family PDZ domain 0.056
Further Details:      
 
Domain Number 2 Region: 329-388
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000289
Family Eukaryotic proteases 0.085
Further Details:      
 
Domain Number 3 Region: 200-248,282-394
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000488
Family Eukaryotic proteases 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258511735|ref|YP_003185169.1|
Sequence length 416
Comment stage IV sporulation protein B [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
Sequence
MAGWLRALKVAVLVAATALLWIPPVRHLVELPTSVEMSTDDEMALQSFHPFSIHAWVRPV
DPPGAVTVTADAGDFDVTDRVFGFIPWRTRVHVEPAERVIVGGQAVGIRLLSEGPMVIGY
RRAAQGISLAEAHHIEVGDVILSVDGVPVHTAKDLQAVLRDKRAPFRLLVARGDKLREIE
IRDVHGVPELGVYVRDKAVGVGTLTFYDPATGRFAALGHLVTDADTGQPIQGRGSVYQAA
IIGIQAGKAGQPGEKKGVFTGVNREVGEIDENTPYGVFGRMDASFATRTSPLPGPIPVAL
PGQVHPGPAVLYTVLHGEKIEAFQVVIEHTARQMSPSTKSMIIRVVDPRLLQAAGGIVQG
MSGSPIVQDGRLVGAVTHVFVSDPVRGYGVYAYWMLHPNQHELTFAPTEPERAQAA
Download sequence
Identical sequences C8WXF9
521098.Aaci_1768 WP_012811073.1.29831 gi|258511735|ref|YP_003185169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]