SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125973324|ref|YP_001037234.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973324|ref|YP_001037234.1|
Domain Number 1 Region: 468-637
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.25e-45
Family Histidine kinase 0.00043
Further Details:      
 
Domain Number 2 Region: 663-787
Classification Level Classification E-value
Superfamily CheY-like 1.57e-41
Family CheY-related 0.0021
Further Details:      
 
Domain Number 3 Region: 287-394
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-23
Family Flavin-binding PAS domain 0.012
Further Details:      
 
Domain Number 4 Region: 398-481
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.34e-23
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 
Domain Number 5 Region: 140-270
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-21
Family Heme-binding PAS domain 0.06
Further Details:      
 
Domain Number 6 Region: 16-154
Classification Level Classification E-value
Superfamily CheY-like 0.0000000107
Family CheY-related 0.013
Further Details:      
 
Domain Number 7 Region: 763-776,813-899
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.000000235
Family Phosphorelay protein luxU 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125973324|ref|YP_001037234.1|
Sequence length 902
Comment PAS/PAC sensor hybrid histidine kinase [Clostridium thermocellum ATCC 27405]
Sequence
MDCRVKNEVRDDLNVNLEVMVAGNDEEFAASLKNALLDVGCKHSVKSAATFNEFKNYLRK
NNFHIVFFDCSSDISFADVMESFENLKKEMPVVAVLEEDGSRHGFEMIKLGACEYLEKKD
SSRLRSIIFKRCRELERERERIRFEKRLKEENERLLTTLESIGDGVIVTDKAGCVIMMNK
AAQELTGYLSCNSIGKPLSEVFVIINGVNREPEPDPYERVLSERKTVGLRKNTMLVSKDG
TLRYVSASTAPIKSSDREIMGVVVVFRDITRIRKAEEKLQKLSQAVEQSPGIIVMADTRG
NIEYVNPRFTEVTGYSFDEVKGKSLFFMELEENGEEKCKDMIQAVFSGKEWRSEIRHKSK
NNVVFWEYAYYSPIINSEGVVTNYLKVSEDITERKLMSENLFKAKEAAEAANRAKSEFLA
NMSHEIRTPLNGIIGMTNLTLQTELTDEQRENLNIVNSCAELLLRVINDILDYSKIEAGK
MTLENVKFDFFNLLEKTYKAHIVQANEKGLRLSYTVQKGIPRILVGDPGRLQQVLNNLIS
NAVKFTDIGEVRIDVDIIEKRDDSVKLKFTVSDTGIGIDGDKMNMLFKSFSQVDSSITRK
YGGTGLGLAISKQLVEMMGGEIWVESQKGKGSTFYFTAGFKRKAKSSVKAECTSNADERV
LGRKLNILLAEDDKVNQQVIAGMLKKEQCSLTIAENGFEAIKLFEENEFDLILMDVQMPE
MDGIEATKRIRKMEEGTFRHIPIIAVTAFAFENDREKILEAGMDDYISKPFSFDDIYAAI
NRVLYKDEQSSDDMQKEKEDEKGSLDPDEKVNETLSESGTVNETGPDYSLKDIMERLDLS
ILNGNFTAIDKSALAVKEFAQNRGFDKVKNLAFKIQLSARKNQLEDVKKLYEVLKQEISK
FN
Download sequence
Identical sequences A3DDL2
gi|385778763|ref|YP_005687928.1| gi|125973324|ref|YP_001037234.1| 203119.Cthe_0806 WP_003518707.1.19387 WP_003518707.1.20586 WP_003518707.1.31213 WP_003518707.1.55520 WP_003518707.1.6636 WP_003518707.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]