SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256419895|ref|YP_003120548.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256419895|ref|YP_003120548.1|
Domain Number 1 Region: 2-98,175-284,641-707
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.51e-29
Family Prokaryotic proteases 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256419895|ref|YP_003120548.1|
Sequence length 718
Comment hypothetical protein Cpin_0849 [Chitinophaga pinensis DSM 2588]
Sequence
MKKNLLILLFLLAAQFAKADEGMWLPYLLGQQVYNDMVKKGLKLTKEQLYSINKASLKDA
IIIFGGGCTGEIVSNQGLIFTNHHCGYDAIATASSVEHNYLKNGFYALDKSQEIPAKGLS
VQFLVKVDDVTKQVMDGLKDLSGPERMQQQQKIIGDIVSQAINGTNYEAKVLPIFKGNQY
LLFVYERYKDIRLVGAPPESIGKFGGDTDNWEWPRHTGDFSVFRVYADKDGKPADYSAAN
LPLKPKHFLPVSIKGIKENDYAMIFGYPGGTNRYESSEGVKLKIDVENPSIVALRAVRLS
YMFEQMKKDPAIKLKLASSYAGIANYWKFFDGEAKQLVKYHVVDEKQKEEAAFGKWANGK
TEYANIFADYATNYKAWAPYAKHRIYINEGIMGSPLAAFAASLQAVEKAMVQSGGSAEAI
KQSIQAADKARTVFLEEEDKTSDQKILAATCHLFYTDIPVAQHPIGFYDAIKAKFGSLDD
NNTYRLWASAIMSGSMIMNDARWKAFVANPDAVTLQTDPAFAYSSAFVKNFSTKYLSIYN
QFVTKNNDLGRTYMKGKLEMEPNKKWYPDANFSMRLTYGQVKPYAPRDAVAYDYVCTMKG
VMEKYKPGDYEFDLPENYVSLYNKKDFGQYKDLRKNDIVTCFITTNDITGGNSGSPVLNA
NGELIGLAFDGNYEALSHKIQFDAVYNRTICVDVRYVLWCIDKLGGASNIINELKLIR
Download sequence
Identical sequences C7PK06
WP_012788523.1.2976 gi|256419895|ref|YP_003120548.1| 485918.Cpin_0849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]