SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256422240|ref|YP_003122893.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256422240|ref|YP_003122893.1|
Domain Number 1 Region: 392-576
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.36e-20
Family Prokaryotic proteases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256422240|ref|YP_003122893.1|
Sequence length 582
Comment hypothetical protein Cpin_3225 [Chitinophaga pinensis DSM 2588]
Sequence
MQFRNLAKEYPEYLNDRYAISFYSYGNKALTKEEREAFIEKWKSGTATLKDWIRAGSDAF
SASTLINDPEAIGETTAARRSKLYDWWIESIVQQYHMRRIKDVLRYTPSYVQEYAKLSLE
ELDQFLSGNLGRYEEQRFRQELGLKAEVNYGKLISDFNSGVLKSSEDIHDPQLAHHAEAI
LRYKSYLELIAAQGIETPQQNGHSTDSLTPQSLWPEIFELGKNITVKYRSQDHYYKEDAF
VDYQIISVSGSYSPSSLRNKIVSLFQPGFEKLIAEIRTESIEDQADIISEIKDELEELKD
YVQKAEYVKEESEYGPRKEYHFLKFDHLKFEGDSPSTFAFHDSSRLFISRKLAPYADEWL
EGINEISRKLEHAANSLHLLKQSSTPVTYDVEAILSNVFVVESPSGGLQGTAFHLKGVGL
VTCDHCIVDPTTGNILTDLVIYRGGDLNQKIQVKVLKHNEHMDLAILEIPEESLSFLKDG
LTVGNSDALKHLDDIAVAGYPNYNFGDTGYFNLGRVSGFRVINGMSHVLVSNILVGGNSG
GPALNASGEVIGIVATGADNFRQSHTTEWHGIIPSNILQFLK
Download sequence
Identical sequences C7PQR9
WP_012790868.1.2976 485918.Cpin_3225 gi|256422240|ref|YP_003122893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]