SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256422487|ref|YP_003123140.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256422487|ref|YP_003123140.1|
Domain Number 1 Region: 368-585
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.4e-17
Family Extended AAA-ATPase domain 0.083
Further Details:      
 
Domain Number 2 Region: 10-190
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000000016
Family Prokaryotic proteases 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256422487|ref|YP_003123140.1|
Sequence length 1283
Comment hypothetical protein Cpin_3472 [Chitinophaga pinensis DSM 2588]
Sequence
MITGDKAKFIDVAAFLLHLQRTSGSTLYIVSASGRFTGWLLTTELVVIPGFGYLDETEEE
FTCYSSATVDSAPLKARLVSIAGKWIKDHERVALLKLEKPVSYPIHHLQTENCKPEDDVM
VLQYPQGTRALQLSFGKIREVNDKWIAYDADTLPGSSGAPVINIQNGKLIAMHLLAGVGE
KRYNSGVTTAGIIGFLRTTDYWPQIAAAHQLLDAKSILSKDLEFSQPTPQWDEIHYKAAV
QWNIDPTVLSEEEKKALSPHLISKQTPVWALKPVDRQQILTSTSIDSLRNIESGIDNHQP
GQKVIRRILNGGPYNLDEVDVEELPYWLQAVRWFKGIDETLPGPAEVDGILQKRRIRAAL
TNLGGAGFRGREEELNTLKTWYEDNRQGSIVISGIGGIGKTALISHFCLQLPENTLLLWL
DFDRADLTPDDPQSILRILIGQIRVQRADFVAPPDNNDWKVMFKALGENLNKTQKALTPS
LMVLDGFEVAQYAKQYQGIWELLNIILKECPSIKVIVSGRAAVASLKLADKPAASLRLTG
MKIQDAEEVLEKNGLKNAAVIRKMATMSKGIPLILKLVIHYVNKGGDENELQHGLPKDTI
EGYLYRRILYRVLDADLQPLIREALILRKITRDIINEILFSLLPANTTVDEVFDKLSKEM
SLLEDGQEGLATIPGEEDVLKLRPELHTSTIRLLELEDAAYVRSVDQKAVDYYRKQDLSF
HEHTAELVYHSLRLGNLQDAKKHWRPEIALYLKNSVEDLPEKNKAEKDWLKDMINQSLSE
TKDDIAIWESETYTILKESIARKSYSDSVRQILNHRKERSADSPLLIYDAWVTWQEGNLE
AAIRLLKNSKTTEPRIRKDQLIFLALLETYNGNRAIADHYLSQINTDQWSNRQFGNTENL
AVAAARMRLTVDLERELRVLQAIREEAGVKRMVLEQHILQRRDVVWPALIEVLDNRTDDN
YVAAYQSLTDKEGRLKYETSGKFRLGMNASDIRSLNERNQSFIRSNAENTSSPVLFESIW
YLLMLSEFRQKQLTDKDVLRDILEIATIPRKSMSTLEVAIVFSLTVFHGEEMPVLYKSFR
SPSVDDLILNVASKYIQTGLPPLELRREELLTTYLRERNLSSNSNIQTQFLIDIIQRGND
ADRQDIVRIIRNMRDEKLAAVIFYLVGPDPLEVLCKGLLGVGEESKLNAKQKITPTGMEL
EDLVDAVSKMPMDINDIMRYLLAEHVKVQMIDLSGSPRMIWLNVINYLVQNNQVNTLSDI
LRDLAKDNPQLLTTTERFTTLLR
Download sequence
Identical sequences C7PTE9
gi|256422487|ref|YP_003123140.1| 485918.Cpin_3472 WP_012791115.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]