SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256422568|ref|YP_003123221.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256422568|ref|YP_003123221.1|
Domain Number 1 Region: 130-334
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.23e-22
Family Prokaryotic proteases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256422568|ref|YP_003123221.1|
Sequence length 369
Comment hypothetical protein Cpin_3556 [Chitinophaga pinensis DSM 2588]
Sequence
MAYLSPVEVNDLSLAIAAATDPIANRGALYQSVDPRVMMVMPIGGGAILPKLMTEISFMN
NLERITTGQVPLQIFLQNAALLVSVLPASEKTVRLLLEKVIQLSSGAPPVNIAMAPIINQ
TFIHRDDMVTFSFVEAALKTANSVFKLRIPAFENGQPRLDQSGNPLQFLGTGWLLTDSLL
ITNHHVINARQDGEGEAAETDLLLQGSGAGVISDYNVEGAAENPPAQAIKLEAWQKSLDY
AVIRIPPSGRTPLRRNLLTIQVQQDPIPVNIIQHPGGRSKRYGIRNNLVYASTQDTLCYF
TDTESGSSGSPVFNDKWEVVALHRGAKYVTGVRFQGKDTAYVNVGTHLRLIIDDIQQRYP
ALANEILQG
Download sequence
Identical sequences C7PUM2
gi|256422568|ref|YP_003123221.1| 485918.Cpin_3556 WP_012791193.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]