SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256424246|ref|YP_003124899.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256424246|ref|YP_003124899.1|
Domain Number 1 Region: 8-226
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.74e-28
Family Prokaryotic proteases 0.0021
Further Details:      
 
Domain Number 2 Region: 388-453
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000106
Family PDZ domain 0.05
Further Details:      
 
Domain Number 3 Region: 307-389,506-561
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000345
Family Prokaryotic proteases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256424246|ref|YP_003124899.1|
Sequence length 567
Comment PDZ/DHR/GLGF domain-containing protein [Chitinophaga pinensis DSM 2588]
Sequence
MRKNQLLILFLLLIAGNTYCQRPAAFQPSALQTISTQLPPAYVRMWTYDTTTHQQMSATF
SGVVVTKEGHILTVAHTTVPGNTYMVTFTDGRAAIAMALGKINFPETPELPDVAMMKILT
PGDWPVAPMGWSYDLKENEPCFSIAYPESLNQPLPMMTAGHITRVKNEKGFIESTCMMEP
GDSGGPLFDYLGRVIGLRSAIEPDEKKNYDVPVDLYRKYWAALLQPVHYLKYPEIRDSIN
TDPSEGLISSHDQLESLRLTMKTNKLNKMASVQVESVAGNQQRSINGLLIDVKGQSFVVS
KNSEVAQEPLVLYNGKSIKTRIIARDKENDLVLLGLDAHVKGGIAFPVNGPVAIGRGVFL
LSPQPDTLAIASVFGKDTFSLPKMSSLGFLGAAIAPDKQPLVLTYVMPGSPADAKGATPG
DEIISINGVAVNEPMDYGRELSAYWPGDTVIIKRRLHAVAEGTDGVAGKVHQVAEVNDTI
VLAKRPQLPATHATDLFRGGKSERRDGFQSVIAHDAILRPEQCGGPVFTTAGVLAGINIA
RHSRTVTLAVPAALVQAFVLQNIGVKH
Download sequence
Identical sequences C7PSD4
WP_012792866.1.2976 gi|256424246|ref|YP_003124899.1| 485918.Cpin_5267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]