SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256424915|ref|YP_003125568.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256424915|ref|YP_003125568.1|
Domain Number 1 Region: 58-86,126-315
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.75e-61
Family Prokaryotic proteases 0.0000162
Further Details:      
 
Domain Number 2 Region: 288-398
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-21
Family HtrA-like serine proteases 0.012
Further Details:      
 
Weak hits

Sequence:  gi|256424915|ref|YP_003125568.1|
Domain Number - Region: 420-490
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00355
Family HtrA-like serine proteases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256424915|ref|YP_003125568.1|
Sequence length 512
Comment HtrA2 peptidase [Chitinophaga pinensis DSM 2588]
Sequence
MKFRQIAATVLISAATAVASIYAYNRFQPRQTGPYQNGSQDIPVNYARYMPGAEVKNATP
PTDFSQAAKVAVPGVVHIKTKINPRQVSNNLQRRRSVLQDLFGDDFFGDEFQGEGGGRKY
YVPGQMASGSGVLISDDGYIITNNHVVDDADEIAVTLNDYKTYKAKVIGTDPNTDLAVIK
IDAKNLPYLLYGNSDDIEIGQWVLAVGYPLNLETTVTAGIVSAKARTIGINKQVRRNAIE
SFIQTDAAVNQGNSGGALINTSGELIGINSAIASPTGAYAGYSYAIPVNLVKKVVNDLMK
YGNVQRAYLGIYYQDPNSIPEERWEEAGIRRDINGVAVTGVVESGSAAAAGIQKGDIITG
INGVSTPSIPQMTEQIARYKPGDKISISYLREGKQFTQSTVLKNADGNTEIVKSSVLDAL
GADLITLNKADAAKVGVRGGVYVDNISSGILKKQTNMKRSFIILKAGGQPVNSIEDLKKI
LDKEKKVQMEGVYPELNGVYYYNIDLANGQEF
Download sequence
Identical sequences C7PEF8
WP_012793533.1.2976 485918.Cpin_5949 gi|256424915|ref|YP_003125568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]