SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387790513|ref|YP_006255578.1| from Solitalea canadensis DSM 3403

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387790513|ref|YP_006255578.1|
Domain Number 1 Region: 59-100,177-287,635-708
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.63e-25
Family Prokaryotic proteases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387790513|ref|YP_006255578.1|
Sequence length 712
Comment Peptidase S46 [Solitalea canadensis DSM 3403]
Sequence
MKFKKVLLIALAIIGFTNAVKADEGMWLPMLINKNYDQMKRQGFKLTPQDIYDINKGSLK
DAIVWFGGFCTGEIVSEKGLVLTNHHCGYDVIASKSTPQDNILDNGFWAKNTAEEKPAEG
LFVSILVRMEDVTAQVNAATKGLEGAEKAAKYAEISKEIVAKATSGTGYEAFVRDMFKGN
QYFVFVTEKYSDIRLVGTPPQSVGKYGGDTDNWIWPRHTGDFSMFRIYAGKDNKPAAYAK
DNVPFTPKRSLAVSLKGVKEGDFSMVFGYPGRTNRYENSYGIKLAVEKVNPAIVKLRDIR
LKSWKEQMEKSDSVRLLLSSEYANIANYWKYFIGQTEQLKHLKVYDYKKGEEAKFQSWSA
SKPEYSSILADYGKAYDAYTPYALYPIYLSQGIFGATAVSFARSFMPVEAGLKAGKVDAV
APMKEHAEEFFKSFNLPSDKKILAGTLLAFYNDIPKDQHPALIGEILAKYGADDPEAAFK
KYSDDVYANSMFASKAKTEAFLAAPELGKLQNDPAYQYVTAFISNYREKFMKNVDAFNAT
NGALGQKYVKGIMEMNPGKLMYPDANSTMRLTYGNIKAYAPKDAVKYDYETTIDGVIEKY
VPKDSEFDLPANYLELYKKKDFGQYANEKGQLIVGFISNNDITGGNSGSPVLNGNGELIG
LAFDGNWEAMSGDIVFDQKYKRTICADIRYVLWCVDKLGNAPHIVKEMKIVK
Download sequence
Identical sequences H8KQA7
WP_014679629.1.74489 gi|387790513|ref|YP_006255578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]