SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387790912|ref|YP_006255977.1| from Solitalea canadensis DSM 3403

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387790912|ref|YP_006255977.1|
Domain Number 1 Region: 155-327
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.22e-35
Family Prokaryotic proteases 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|387790912|ref|YP_006255977.1|
Domain Number - Region: 70-143
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0785
Family Hemolysin E (HlyE, ClyA, SheA) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387790912|ref|YP_006255977.1|
Sequence length 365
Comment trypsin-like serine protease with C-terminal PDZ domain [Solitalea canadensis DSM 3403]
Sequence
MYGDLNLFNEIERYLKGEMTETERANFDMLRKEDADLDHKVVEQEQFVQRLTNVGNRRAL
RTQLNAIHSEIDVNELKGSIQPKEGKIIQLFRRYRANIAVAATVAFFTVIGTLLITKNTG
SEKQNSSYSALRRDMESIKRSQNALIRNINSTKTKMPATPGSFGGTSFVLSTDGFLITNY
HVINGADSIYIQNEKGEAYKVKTVYSDPSFDLAVLKIDDPSFKSFGSLPYTFKKSKSDLG
EEVFTLGFPRDEMVYGKGYLSAATGFGGDTIAYQVSIPANPGNSGGPVVDNKGNVVGVIS
GKQTLTEGATFAVRSQSVLKFINSIPQDSLKSKITVTKKNTLSGLSRTQQIKKLQDYVYM
VKVYN
Download sequence
Identical sequences H8KTV1
gi|387790912|ref|YP_006255977.1| WP_014680028.1.74489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]