SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387792434|ref|YP_006257499.1| from Solitalea canadensis DSM 3403

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387792434|ref|YP_006257499.1|
Domain Number 1 Region: 70-145,229-385
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-24
Family Prokaryotic proteases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387792434|ref|YP_006257499.1|
Sequence length 397
Comment hypothetical protein Solca_3316 [Solitalea canadensis DSM 3403]
Sequence
MSTENFNNENSLESNDLSAQDSSVKPKNKWLLPSIFVIVGIVITVLFFKAGDLKKLWSGQ
APDSLKCGLSQTEIYEKYKNSVVLVANSYVYEVKVKGSSPFYLTITENGELAPYDENLNN
PITITGTGFFVSKDGKLVTNRHVASPWVTNQSEAFTAIKQTVSYMVPDDVNPAQVGKYIT
QHWTDEITEGNEEEWEAVHTTDSAAVASDSTASEITINIPENKSSNPTDTSQIVVTGKIV
RLGIAMHNSKVKEIRDFIPCEYITEATDPNVDVAIIQTISHNLPAKVKNVINLNQAANDD
TDIKPGTKAIMIGYPMGMQLAGTQKGVKVQVYEGEINKESDGFAIQYNITSTHGASGSPV
FDDCGRLVAVNYAGYDQTQGFNFGVVAKHALALYQAE
Download sequence
Identical sequences H8KWZ4
WP_014681546.1.74489 gi|387792434|ref|YP_006257499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]